SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060887 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060887
Domain Number 1 Region: 819-883
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000523
Family ATI-like 0.037
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000932
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 717-781
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000491
Family ATI-like 0.037
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060887
Domain Number - Region: 861-922
Classification Level Classification E-value
Superfamily FnI-like domain 0.000617
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number - Region: 1195-1249
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000654
Family ATI-like 0.092
Further Details:      
 
Domain Number - Region: 421-462
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family Fibronectin type I module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060887   Gene: ENSPTRG00000040353   Transcript: ENSPTRT00000074856
Sequence length 1640
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:48972802:49055176:-1 gene:ENSPTRG00000040353 transcript:ENSPTRT00000074856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLILWYLVVALWCFCKDVEALLYRQKSEIQKRESGGFFNGSSSSGDSDQKKPLFSFEFG
ATGEDEDKSRERWDAGNSRSEDSPAGVTSSSEYSTSGPLSTPEKGSHIPEATPKYSETNA
IIGEISTWSKGAYKSFNGRIFFFESSCPYTFCRHCVESGGDFNIEIKRNNDSEIEKITVL
IDNNDISIFGDTILVNGESVHIPYNNKLIHIKKYGEHNVLNSRRGILTLMWDKNNKLSLT
LHKQYPTCGLCGNFNSTPGQDINEHIANSKIPGDCPNAVGKSYEVCEDGIQHCNKIIGTY
FEKCGKVAALSNDYKMICIDEYCQTRDKTSTCDTYSELSRLCASDGPGTFESWRSDSDVV
CETQRCPEQHIYKECGPSNPATCSNVAPFQDSECVSGCTCPEGYLLDDIGEKGKCVLKAE
CPCESSGTVYPPGEVREGPCGSQCTCQDAKWSCTEALCPGRCKVEGSSLTTFDGVKYDFP
GNCHFLAIHNEDWSISVELRPCPSGQTGTCLNSVTLLLNSSVPVDKYIFNSDGTVTNDKI
RNQGYYYSDKIQILNASSSYLQVETYFHVKLQIQIVPVMQLYVSMPPNQFTDTVGLCGSY
NNKAEDDFMSSQNILEKTSQAFANSWEMMSCPKGNPSSCISIEKEKFAERHCGILLDSSG
PFASCHPIVNPKPYHEECKKYTCTCENSQDCLCTILGNYVKACAEKETYIVGWRTGLCEH
SCPSGLVFKYNVKACNSSCRSLSERDRSCDVEDVPVDGCTCPDEMYQNNEGNCVLKSQCD
CYINDEVMQPGKLIHIDDNKCVCRDGILLCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTD
RTCSTRNIPVFDENLPCKRGCFCPEGMVRNSKGICVFPNDCPCSFGGREYDEGSVTSVGC
NECTCIKGSWSCTQNECQTICHIYGEGHVRTFDGKSYSFDGLCQYSFLEDYCGHENGTFR
ILTESVPCCEDGLTCSRKIIVAFQDQNIVLQDGKVTAVKSTESKKCELNANAYSIHTVGL
YLILKFQNGIIVIWDKNTRLSVILDPNWNGKVCGLCGNNNGDLKDDFTTRYSSVASGALE
FGNSWKTSQECSDTVAQTFPCDSNPYCKAWAVRKCEILRDSTFRDCHNKVDPSAYYDACI
EEACACDMEGKYLGFCTAVAMYAEACSAVGVCVSWRKPNLCPVYCDYYNAPGECRWHYEP
CGTVTAKTCKDQLVGQKFSSLLEGCYAKCPDSAPYLDENTMKCVGLSECSCFYNDVIPAG
GVIEDNCGRTCYCIAGQLVCSETAPTNSTFAVSTTTATTILSTGAAITLVTGGPSTAASI
PAITTSSSETTGTTLGPLTEPFTTGITETSAPIISTSGNAGMTGVVSSTVTGASGMAGTT
GGVDAATTGAASENTSERAGTPRVSGATPAVGSGSTPGEAGPGATVSGSTGVSAGSTTAS
PGASATTSESSKSGTTGPSVGGKTGATSSEATSSEGMSGVTGQSLGSTAGSDSEITAKTS
FTGSSPPGKLTRPSPGSPGHFSGGTTEGGNVATTGAAGENTSGASGSAEGSVEATTSAGS
GNAAGTSGTGDTGPGNTAVSGTPVVSPGATPGAPGSSTPGEADIGTTSFGKSGTPTVSAA
STTSSPVSKHTDAASATAVT
Download sequence
Identical sequences ENSPTRP00000060887 ENSPTRP00000060887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]