SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060983 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060983
Domain Number 1 Region: 212-309
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-17
Family I set domains 0.058
Further Details:      
 
Domain Number 2 Region: 321-410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000128
Family I set domains 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060983
Domain Number - Region: 35-111
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000207
Family I set domains 0.069
Further Details:      
 
Domain Number - Region: 107-178
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0703
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060983   Gene: ENSPTRG00000016067   Transcript: ENSPTRT00000072891
Sequence length 413
Comment pep:novel chromosome:CHIMP2.1.4:4:75323841:75374630:-1 gene:ENSPTRG00000016067 transcript:ENSPTRT00000072891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFVPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASIAFNVYVNSKL
Download sequence
Identical sequences ENSPTRP00000060983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]