SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061088 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061088
Domain Number 1 Region: 846-1011
Classification Level Classification E-value
Superfamily L domain-like 8.5e-22
Family Ngr ectodomain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061088   Gene: ENSPTRG00000041217   Transcript: ENSPTRT00000076005
Sequence length 1622
Comment pep:novel chromosome:CHIMP2.1.4:10:27596180:27601868:-1 gene:ENSPTRG00000041217 transcript:ENSPTRT00000076005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAHCAVPACVMSRLCFWGLWPLLTWQLLWLLVKEAQPLEWVKDLLQLTSNPRGPPEPW
SSSSHLPWESPHAPIAPADPGDFDYLGPSASSQMSAPPQSTENLVPFLDTDSAGELPLGP
EQFSVAHQDFNDKLTLQERLPVSPRNLKKDLAQHWSIADIVGIPQQLSKLQRKQTLQDEY
SSMDTQYPGSLPPELRVNSDEPPGTPEVGLSQFHLEPETQNPETLEDIQSSSLQEEAPEQ
LPQLLTQQAAPALPPESSMEILAQTLPNHEVTVQPPGEDQAHYNLPNITVKPADVEVTIT
SEPTNEKESSQAQQEAPVQFPEEVEPSATQQAPTEPPCHPTERELSISEQEQPAQPSESS
GEVESSQTQQETPAQPPEHHEVTVSPPGHHQTQHSDLPNVSVKPPDMQLTIATEPSAEVG
TSPVHQEATAQLSGPGNDVEPPTIQHGGPPLPPESPEDAGPLAIQQETSVSPEPINNENP
SPTQQEAAAEHPQTAEKGKSSLTQQEAPAETPELPNVVVAQSPEHSNLTQATVQPLDLGL
TITPESTTEVELSPTMQETPTHPPKKVVTQLPVYQEVTIPTPGQDQAQHPMSPSITVQPL
DLGLTITPEPTTEVGHSTPLKKNVVPPKHPKVTLPHPDQVQTQHSNLTQATVQPLDLGLT
TTPESTTEIEPSAALTTTAPPPEHPEVTLPLSDKGWAQHSNLTQVTLPPLDLELTITTEP
TTEVKPSPTTEETSTQPPDLGLAITPEPTTETGHSTALEKTTAPRPDQVQTLHRKLTEVT
GPPTELEPTQDSLVQSESYAQNKALTAPEEQASTSTNICELCTCGGETLSCIDLSPKQRL
CQVPVPEPNTYHGTFTILNFQGNYISYIDGNVWKAYSWTGKLILNENYLTELHNDSFEGL
LSLQYLDLSCNKIQSIERHTFEPLPFLQFINLGCNLLTELSFGTFQAWHGMQFLHKLILN
RNPLTTVEDPYLFKLSAFKYLDMGTMQVPLTTIENILVMTVELEKLILPSHMTCCLCQFK
NSIEAVCKTVKLHCSSACLTNTIHEETSVENPGVFMKVLQAQKKHTSTKLTIEPEAASDS
NGINLSGFGSGQLDTNDERDVISALSYILPYFSAVNLDVKSMSLPFINLLTTGNSLAKIQ
SVGKNLQRVNRVLMGPRSILKRHFKEGKQRIRRERGAQAFAENAAKEKRLGSPAPRELRQ
PHIEQGPDKLVGNTIYTKPSFIQEHKAAVSSVLKPFSMGVPSASTPAKALPQVRDRAKDL
TYTIFILENAKARVKNMKAAKPIIHSRKKYRFHKTCSRVAHRTLKAKKSPKFRKKSYLNR
LMLAKRPPFSAVKSLINSLSQRAFSSLGDSSPQENPFPEVFAPSERFIENTNVKNTTARN
AFEENIFMENTTRPGTISENTTHNHPPEADSAGTAFNLGPTIKQTETKWEYNNVGTDLSP
EPKSFNYPLFSSPGDQFEIQLTQQPRSLIPNNNVRRLISHVIRTLKMDCSETHVQLTCAK
LISRTGLLMKLLSEQQEVKVSKAEWDTDQWKTENYINESTEAQNEQKEQKSSELTKEVPG
YGYNNKLILAIFVTEILTTMIIIFCLIEIYSHRWSSQEDGEGFSRDSETPTEKGEESEAL
PP
Download sequence
Identical sequences ENSPTRP00000061088 ENSPTRP00000061088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]