SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061095 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061095
Domain Number 1 Region: 2-308
Classification Level Classification E-value
Superfamily L domain-like 1.67e-53
Family Internalin LRR domain 0.072
Further Details:      
 
Domain Number 2 Region: 403-543
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.01e-36
Family Gelsolin-like 0.00028
Further Details:      
 
Domain Number 3 Region: 1069-1177
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.25e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 523-634
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.16e-24
Family Gelsolin-like 0.00072
Further Details:      
 
Domain Number 5 Region: 813-857,892-977
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-23
Family Gelsolin-like 0.013
Further Details:      
 
Domain Number 6 Region: 612-762
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.87e-21
Family Gelsolin-like 0.0028
Further Details:      
 
Domain Number 7 Region: 967-1059
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000351
Family Gelsolin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061095   Gene: ENSPTRG00000008847   Transcript: ENSPTRT00000076109
Sequence length 1184
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:37661396:37675297:1 gene:ENSPTRG00000008847 transcript:ENSPTRT00000076109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLRWLKLNRTGLCYLPEELAALQKLEHLSVSHNNLTTLHGELSSLPSLRAIVARANSL
KNSGVPDDIFKLDDLSVLDLSHNQLTECPRELENAKNMLVLNLSHNRQLPAMTALQTLHL
RSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPECLYTLPSLRRLNLSSNQITELSLCI
DQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLNSNKLDFDGLPSGIGKLTNLEEFMAA
NNNLELVPESLCRCPKLRKLVLNKNYLVTLPEAIHFLTEIEVLDVRENPNLVMPPKPADR
AAEWYNIDFSLQNQLRLAGASPATVAAAAAGSGPKDPMARKMRLRRRKDSAQDDQAKQVL
KGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQI
ENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAV
NWRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYG
KKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKG
KAEITLLVQGQELPEFWEALGGEPSEIKKHVPDDFWPPQPKLYKVGLGLGYLELPQINYK
LSVEHKQRPKVGLMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQE
LCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRD
AEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDLDGMEGFVLEGKKFARLPEEEFG
HFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEEKAEGKEGEEATAEAEEKQPEEDFQCIVY
FWQGREASNMGWLTFTFSLQKKFESLFPGKLEVVRMTQQQENPKFLSHFKRKFIIHRGKR
KAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPFESEDNQGIVYAWV
GRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
LFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNGQEVYMWVGTQTSQVEIKLSLKACQ
VYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAWSAFCKALA
Download sequence
Identical sequences ENSPTRP00000061095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]