SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061149 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061149
Domain Number 1 Region: 333-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 2 Region: 432-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 236-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000132
Family Growth factor receptor domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000061149
Domain Number - Region: 400-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00393
Family Laminin-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061149   Gene: ENSPTRG00000021303   Transcript: ENSPTRT00000072686
Sequence length 634
Comment pep:novel chromosome:CHIMP2.1.4:9:119625403:119742677:-1 gene:ENSPTRG00000021303 transcript:ENSPTRT00000072686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLPSLGGLALLCCAAAAVASAASAGNVTGGGGAAGQVDASPGPGLRGEPSHPFPRATA
PTAQAPRTGPPRATVHRPLAATSPAQSPETTPLWATAGPASTTFQAPLGPSPTTPPAAER
TSTTSQAPTRPAPTTLSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSNSSVLPTPPAT
EAPSSPPPGHQPVAKMPQKYLGKYACESNLKSKYLPLIQPVMNLRVSEAVKTEYVCNCSV
VGRLDVNRCNQTTGQCECRPGYQGLHCETCKEGFYLNYTSGLCQPCDCSPHGALSILCNS
SGKCQCKVGVIGSICDRCQDGYYGFSKNGCLPCQCNNRSASCDALTGACLNCQENSKGNH
CEECKEGFYQSPDATKECLRCPCSAVTSTGTCSIKSSELEPECDQCKDGYIGPNCNKCEN
GYYNFDSICRKCQCHGHVDPVKTPKICKPESGECINCLHNTTGFWCENCLEGYIHDLEGN
CIKKEVILPTPEGSTILVSNASLTTSVPTPVINSTFTPTTLQTIFSVSTSENSTSALADV
SWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELKEDNISFSSYHDS
IPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSPTRP00000061149 ENSPTRP00000061149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]