SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061216 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061216
Domain Number 1 Region: 23-401
Classification Level Classification E-value
Superfamily L domain-like 3.4e-58
Family Ngr ectodomain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061216   Gene: ENSPTRG00000040740   Transcript: ENSPTRT00000076159
Sequence length 622
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:52728228:52730942:-1 gene:ENSPTRG00000040740 transcript:ENSPTRT00000076159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGLQFSLPCLRLFLVVTCYLLLLLHKEILGCSSVCQLCTGRQINCRNLGLSSIPKNFPE
STVFLYLTGNNISYINESELTGLHSLVALYLDNSNILYVYPKAFVQLRHLYFLFLNNNFI
KRLDPGIFKGLLNLRNLYLQSNQVSFVPRGVFNDLVSVQYLNLQRNRLTVLGSGTFVGMV
ALRILDLSNNNILRISESGFQHLENLACLYLGSNNLTKVPSNAFEVLKSLRRLSLSHNPI
EAIQPFAFKGLANLEYLLLKNSRIRNVTRDGFSGINNLKHLILSHNDLENLNSDTFSLLK
NLIYLKLDRNRIISIDNDTFENMGASLKILNLSFNNLTDLHPRVLKPLSSLIHLQANSNP
WECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKS
PHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTA
VLPVQIQLTTSVTLNLEKNSALPNDAASMSGKTSLICTQEVEKLNEAFDILLAFFILACV
LIIFLIYKVVQFKQKLKASENSRENRLEYYSFYQSARYNVTASICNTSPNSLESPGLEQI
RLHKQIVPENEAQVILFEHSAL
Download sequence
Identical sequences A0A2J8L1E1
ENSPTRP00000061216 ENSPTRP00000061216 XP_003310751.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]