SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061259 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061259
Domain Number 1 Region: 31-163
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-23
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 2 Region: 233-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000135
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061259   Gene: ENSPTRG00000028521   Transcript: ENSPTRT00000055398
Sequence length 757
Comment pep:known chromosome:CHIMP2.1.4:11:64274974:64277247:-1 gene:ENSPTRG00000028521 transcript:ENSPTRT00000055398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRLLLAWAAAGPTLGQNPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLAT
PRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQP
ASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYT
TPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNG
GCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF
RPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA
SQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREP
QIPYPEPTWPPPLSAPRVPYHSSVLSVTQPVVVSATRPTLPSAHQPPVIPATHPALSRDH
QIPVIAANYPDLPSAYQPGILSVSHPAQPPAHQPPMISTKYPELFPAHQSPMFPDTRVAG
TQTTTRLPGIPPSHAPLVTTLGAQLPPQAPDALVLRTQATQLPIIPTAQPSLTTTSRSPV
SPAHQISVPAATQPAALPTLLPSQSPTNQTSPISPTHPHSKAPQIPREDGPSPKLALWLP
SPAPTAAPTALGEAGLAEHSQRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGPHAPNK
RITDCYRWVIHAGSKSPTEPMPPRGSLTGVQTCRTSV
Download sequence
Identical sequences H2RIA1
ENSPTRP00000061259 XP_003313194.1.37143 ENSPTRP00000061259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]