SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061360 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061360
Domain Number 1 Region: 3-222
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000168
Family FAD-linked reductases, N-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061360   Gene: ENSPTRG00000003095   Transcript: ENSPTRT00000073454
Sequence length 251
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:133199015:133207963:1 gene:ENSPTRG00000003095 transcript:ENSPTRT00000073454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLF
YGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCV
SGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNG
SFQEAAFPGETFPVSVECEDGDRFLAHHVIVTVPLGLSTFSVGSLPGLSLSSWRLCQMKK
YFCVSPKCSGE
Download sequence
Identical sequences ENSPTRP00000061360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]