SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001022 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001022
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.45e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 71-132
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 461-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000001022
Domain Number - Region: 3-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0033
Family SCAN domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001022   Gene: ENSPTRG00000000591   Transcript: ENSPTRT00000001132
Sequence length 526
Comment pep:known chromosome:CHIMP2.1.4:1:40778408:40797172:1 gene:ENSPTRG00000000591 transcript:ENSPTRT00000001132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDVKTQRESLE
DEVTPGLPTAESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLS
KPSVISQLEKGEEPWMAEKEGPGDPSSDLKSKIETIESTAKSAISQERLYHGIMMESFMR
DDIIYSTLRKVSTYDDVLERHQETCMRDVRQAILTHKKRVQETNKFGENIIVRSNVIIEQ
RHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKC
QKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF
SHRAYLTHHQRIHTGERPYKCRECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDS
SFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFQNKV
Download sequence
Identical sequences H2PYS2
XP_003308062.1.37143 XP_009453185.1.37143 XP_524679.2.37143 ENSPTRP00000001022 ENSPTRP00000001022 9598.ENSPTRP00000001022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]