SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Pan troglodytes 76_2.1.4 > ENSPTRP00000001294

Domain assignment for ENSPTRP00000001294 from Pan troglodytes 76_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSPTRP00000001294
Domain Number 1 Region: 421-681
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 162-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 43-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 256-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 5 Region: 290-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 6 Region: 82-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 116-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 8 Region: 332-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 9 Region: 202-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 373-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 11 Region: 692-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001294   Gene: ENSPTRG00000000754   Transcript: ENSPTRT00000001424
Sequence length 960
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:53694395:53777167:-1 gene:ENSPTRG00000000754 transcript:ENSPTRT00000001424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGRPDPGPLRPLALLLLLLLLRLQHLAAAAADPLLGGQGPAKECEKDQFQCRNERCIPSV
WRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCT
KQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCLAAV
FVCDGDDDCGDGSDERGCADPACGPREFRCGGDGGGACIPERWVCDRQFDCEDRSDEAAE
LCGRPGPGATSAPAACATAAQFACRSGECVHLGWRCDGDRDCKDKSDEADCPLGTCRGDE
FQCGDGTCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECACP
AGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPS
LIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKAS
DPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPR
AIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDS
KLHQLSSIDFSGGNRKMLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEIS
ILAENLNNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCACPD
TMWLGPDMKRCYRAPQSTSTTTLASTMTRTVPATTRAPGTTVHRSTYQNHSTETPSLAAA
VPSSVSVPRAPSISPSTLSPATSNHSQHYANEDSKMGSTVTAAVIGIIVPIVVIALLCMS
GYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAISSFDRPLWA
EPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
Download sequence
Identical sequences H2PZ23
ENSPTRP00000001294 XP_009456320.1.37143 ENSPTRP00000001294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.