SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002038 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002038
Domain Number 1 Region: 107-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000559
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 142-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000188
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 71-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 5 Region: 185-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000617
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002038
Domain Number - Region: 2-26
Classification Level Classification E-value
Superfamily EGF/Laminin 0.031
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002038   Gene: ENSPTRG00000001194   Transcript: ENSPTRT00000002224
Sequence length 230
Comment pep:novel chromosome:CHIMP2.1.4:1:116598798:116830366:1 gene:ENSPTRG00000001194 transcript:ENSPTRT00000002224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVTYHNGTGYCKCPEGLLGEYCQHRDPYEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC
TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQDGGTCLNLPGSYQCQCPQGFTGQYCD
SLYVPCAPSPCVNGGTCRQTGDFTFECSCLPATWPIFPKLLSLQEKESYC
Download sequence
Identical sequences ENSPTRP00000002038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]