SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002570 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002570
Domain Number 1 Region: 21-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-40
Family Pentraxin (pentaxin) 0.00000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002570   Gene: ENSPTRG00000001525   Transcript: ENSPTRT00000002799
Sequence length 223
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:137920182:137921226:1 gene:ENSPTRG00000001525 transcript:ENSPTRT00000002799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKATSKVMEKFPAPVHICVSWESS
SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD
SVLPPENILSAYQGTPLPANILDWRALNYEIRGYVIIKPLVWV
Download sequence
Identical sequences H2Q0D0
ENSPTRP00000002570 ENSPTRP00000002570 XP_003821017.1.60992 XP_513916.2.37143 9598.ENSPTRP00000002570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]