SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002939 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002939
Domain Number 1 Region: 828-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000223
Family Laminin-type module 0.0000607
Further Details:      
 
Domain Number 2 Region: 724-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 286-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 4 Region: 884-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 5 Region: 935-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 447-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 398-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 342-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 773-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 10 Region: 1282-1526
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000157
Family Tropomyosin 0.00058
Further Details:      
 
Domain Number 11 Region: 983-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002939
Domain Number - Region: 1082-1284
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000453
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 
Domain Number - Region: 100-178
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00553
Family Galactose-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002939   Gene: ENSPTRG00000001761   Transcript: ENSPTRT00000003194
Sequence length 1609
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:161601307:161725398:1 gene:ENSPTRG00000001761 transcript:ENSPTRT00000003194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSHRAAPALWPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTLEDGPWIPYQYYSG
SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKP
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPG
FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEW
SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTMKQQSSCNP
VTGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGLCECREGFVGNRCDQCEENYF
YNRSWPGCQECPACYRLVKEKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLREDMRGKELE
VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
KTAAEEALRKIPAINQTITEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNA
TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences H2Q0R1
ENSPTRP00000002939 9598.ENSPTRP00000002939 ENSPTRP00000002939 XP_001162648.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]