SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003790 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003790
Domain Number 1 Region: 310-734
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.88e-107
Family Phosphofructokinase 0.00000709
Further Details:      
 
Domain Number 2 Region: 1-320
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.75e-99
Family Phosphofructokinase 0.00000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003790   Gene: ENSPTRG00000002243   Transcript: ENSPTRT00000004106
Sequence length 746
Comment pep:known chromosome:CHIMP2.1.4:10:3126602:3197668:1 gene:ENSPTRG00000002243 transcript:ENSPTRT00000004106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARC
QAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANIFRKEWSGLLEELARNGQIDKEA
VQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATP
DTPACVVSLNGNHAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLA
IKLPDDQIPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQI
KEIGWTDVGGWTGQGGSILGTKRVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLEL
SAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWIT
VKLKEARGRGKKFTTDDSVCVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLM
KILAKYKASYDVSDSGQLEHVQPWSV
Download sequence
Identical sequences ENSPTRP00000003790 XP_016818045.1.37143 ENSPTRP00000003790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]