SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004018 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004018
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.03e-33
Family Ras-binding domain, RBD 0.0024
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004018   Gene: ENSPTRG00000002373   Transcript: ENSPTRT00000004354
Sequence length 665
Comment pep:known chromosome:CHIMP2.1.4:10:26845845:26972460:1 gene:ENSPTRG00000002373 transcript:ENSPTRT00000004354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQHHSASLQASNFSGAASLGYGTNVAATG
ISQYEDDLPPPPADPVLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERFFEDHENV
VEVLSDWTRDTENKILFLEKEEKYAVFKNPQNFYLDNRGKKESKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGTQHKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPRTGTTQPNGQIPQATHSVSALL
QEAQRHAETSKDKKPALGNHHDPAVPRAPHAPKSSLPPPPPVRRSSDTSGSPATPPKAKG
TGSGGLPAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGTAGSELPP
PPPPPPPAPAPVPDCARPPPAVAKRPPVPPKRQENPGHPGGAGGGEQDFMSDLMKALQKK
RGNVS
Download sequence
Identical sequences ENSPTRP00000004018 9598.ENSPTRP00000004018 ENSPTRP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]