SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005096 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005096
Domain Number 1 Region: 79-266
Classification Level Classification E-value
Superfamily RNI-like 1.31e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.013
Further Details:      
 
Domain Number 2 Region: 18-56
Classification Level Classification E-value
Superfamily F-box domain 0.00000471
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005096   Gene: ENSPTRG00000002890   Transcript: ENSPTRT00000005510
Sequence length 300
Comment pep:known chromosome:CHIMP2.1.4:10:101633466:101636788:1 gene:ENSPTRG00000002890 transcript:ENSPTRT00000005510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFRSLVQLHLA
GLRRFDAAQVGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLARNPQLRSVA
LGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLK
DEAIVYLAQRRGAGLRSLSLAVNANVGDAAVQELARNCPELQHLDLTGCLRVGSDGVRTL
AEYCPVLRSLRVRHCHHVAESSLSRLRKRGVDIDVEPPLHQALVLLQDMAGFAPFVNLQV
Download sequence
Identical sequences A0A2I3RMQ8
XP_001171202.1.37143 XP_009457407.1.37143 ENSPTRP00000005096 ENSPTRP00000005096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]