SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005408 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005408
Domain Number 1 Region: 49-155
Classification Level Classification E-value
Superfamily L domain-like 8.5e-21
Family Ngr ectodomain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005408   Gene: ENSPTRG00000003075   Transcript: ENSPTRT00000005846
Sequence length 530
Comment pep:known_by_projection chromosome:CHIMP2.1.4:10:132142600:132188003:1 gene:ENSPTRG00000003075 transcript:ENSPTRT00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESSSYEVPSVAAADLEEGAGQTRSLPATPSKDVHKGVGGIIFSSSPILDLSESGLCRL
EEVFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLDLRCNRIKALPSGIGAHKHLKTLL
LERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQLVVQKGLVAIQRFLRVWAVEHSFPRN
PTSQEAPPVREMTLCDLSSPGLELSGDHASNQGAVNAQDPEGAVMKEKAGFLPPVEKPDL
SELRKSADSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKATLNIEKE
LPKPRHVFRRKTASSRSILPDLLSPYQIAIRAKRLEESRAAALRELQEKQALMEQQRREK
RALQEWRERAQRMRKRKEELSKLLPLRRSMVASKTPSATDLIDNGKVPLNPAGKMKPSKE
KSPQASKETRALQERNLEEKIKQHVPQMHEQRRFHGQAPLEEMRKAAEDLEIAAELQDEV
LKPKLGLTLKKDRRRAALTGNLSLGLPAAQPQNTFFNTKYGESGSVRRYQ
Download sequence
Identical sequences H2Q2T1
XP_003951833.1.37143 XP_003951834.1.37143 XP_009457820.1.37143 9598.ENSPTRP00000005408 ENSPTRP00000005408 ENSPTRP00000005408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]