SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005906 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005906
Domain Number 1 Region: 10-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.09e-73
Family Proteasome subunits 0.000000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005906   Gene: ENSPTRG00000003385   Transcript: ENSPTRT00000006401
Sequence length 269
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:14314369:14418679:-1 gene:ENSPTRG00000003385 transcript:ENSPTRT00000006401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLSKVKFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQS
ELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGS
KTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLER
HMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLE
GLEERPQRKAQPAQPADEPAEKADEPMEH
Download sequence
Identical sequences A0A2I3LG13 A0A2K5I436 A0A2K5KTS3 A0A2K5W387 A0A2K5YBE5 A0A2K6APR4 A0A2K6LVA4 A0A2K6QGK4 F7GF95 G3QGE3 H2Q378
gi|23110935|ref|NP_683877.1| ENSGGOP00000001399 9544.ENSMMUP00000021601 9598.ENSPTRP00000005906 9606.ENSP00000315309 NP_683877.1.87134 NP_683877.1.92137 XP_005578609.1.63531 XP_009244830.1.23681 XP_011811644.1.43180 XP_011854958.1.47321 XP_011937286.1.92194 XP_016775930.1.37143 XP_018892489.1.27298 ENSP00000414359 ENSMMUP00000021601 ENSMMUP00000021601 ENSPTRP00000005906 ENSGGOP00000001399 ENSP00000379675 ENSPTRP00000005906 ENSP00000414359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]