SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006085 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006085
Domain Number 1 Region: 46-184,238-495
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 4.84e-110
Family Proton glutamate symport protein 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006085   Gene: ENSPTRG00000003502   Transcript: ENSPTRT00000006599
Sequence length 574
Comment pep:known chromosome:CHIMP2.1.4:11:35251595:35409527:-1 gene:ENSPTRG00000003502 transcript:ENSPTRT00000006599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Download sequence
Identical sequences A0A2I2ZRF1 A0A2I3RPT6 P43004
9598.ENSPTRP00000006085 9606.ENSP00000278379 ENSGGOP00000013900 ENSP00000278379 ENSPTRP00000006085 NP_004162.2.87134 NP_004162.2.92137 XP_003313030.1.37143 XP_004050990.1.27298 ENSP00000278379 ENSPTRP00000006085 gi|40254478|ref|NP_004162.2| ENSP00000278379 ENSGGOP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]