SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006229 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006229
Domain Number 1 Region: 279-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-40
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000006229
Domain Number - Region: 138-262
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00497
Family Apolipoprotein A-I 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006229   Gene: ENSPTRG00000029940   Transcript: ENSPTRT00000006751
Sequence length 450
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL391837.1:872939:879163:-1 gene:ENSPTRG00000029940 transcript:ENSPTRT00000006751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGTLQVFQRELTCPICMNYFLDPVTIDCGHNFCRPCFYLNWQDMAVVAQCSKCKKTTR
QRNLNTDICLKNMASIARKASLRQFLSSEEQICGMHRETKKMFCEVDKSPLCLLCSNSQE
HRNHIHCPIEWAAEECREELLKKMQSLWEKACENLRNLNMETTRTRCWKDYVSLRIEAIR
AEYQKMPAFLHEEEQQHLERLRKEGEDIFQQLNEGKARMEHSRELLRGMYEDLKKMCHKA
VVELLQSFGDILQRYESLLLQVSEPVNPDFSAGPIIGLMDRLKRFRVDFTLQPERDNSHI
FLYGDLRSMNIGCDPDDPDITAKSECFLVWGAQAFTSGKYYWEVHVGDSWNWAFGVCNNY
WEEKRQNDKIDGEEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCGRTMSF
VDVDQSSLIYTIPNCSFSPPLRPIFCCSHF
Download sequence
Identical sequences ENSPTRP00000006229 ENSPTRP00000006229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]