SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007275 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007275
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-24
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.3e-20
Family Platelet-derived growth factor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007275   Gene: ENSPTRG00000004227   Transcript: ENSPTRT00000007883
Sequence length 370
Comment pep:known chromosome:CHIMP2.1.4:11:101763742:102024940:-1 gene:ENSPTRG00000004227 transcript:ENSPTRT00000007883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences A0A2I3SLM0 G3QI67 Q9GZP0
ENSGGOP00000002070 ENSP00000376865 ENSGGOP00000002070 9598.ENSPTRP00000007275 9606.ENSP00000376865 gi|13376808|ref|NP_079484.1| ENSPTRP00000007275 NP_079484.1.87134 NP_079484.1.92137 XP_003828415.1.60992 XP_004052090.1.27298 XP_522165.2.37143 ENSP00000376865 ENSPTRP00000007275 ENSP00000302193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]