SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007329 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007329
Domain Number 1 Region: 359-551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 83-184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000357
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000114
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007329   Gene: ENSPTRG00000004261   Transcript: ENSPTRT00000007942
Sequence length 1191
Comment pep:known chromosome:CHIMP2.1.4:11:108461405:108596773:-1 gene:ENSPTRG00000004261 transcript:ENSPTRT00000007942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSGTKKKMKTLAERRRSAPSLILDKALQKRP
TTRDSPSASVDTCTFLSSFVCSSRTLLIDGRAELKRGLQRQERHLFLFNDLFVVAKIKYN
NNFKIKNKIKLTDMWTASCVDEVGEGNTNAMKSFVLGWPTVNFVATFSSPEQKDKWLSLL
QRYINLEKEKDYPKSIPLKIFAKDIGNCAYSKTITVMNSDTANEVINMSLPMLGITGSER
DYQLWVNSGKEEAPYPLIGHEYPYGIKMSHLRDSALLTPGSKDSTTPFNLQEPFLMEQLP
REMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPTSPTSTMPG
QLFGISLPNICENDNLPKPVLDMLFFLNQKGPLTKGIFRQSANVKSCRELKEKLNSGVEV
HLDCESIFVIASVLKDFLRNIPGSIFSSDLYDHWVSVMDQGNDEEKINTVQRLLDQLPRA
NVVLLRYLFGVLHNIEQHSSSNQMTAFNLAVCVAPSILWPPTSSSPELENEFTKKVSLLI
QFLIENCLRIFGEEITSLFREVSVRCDTRENASDISCFQLNDSSYDSLENELNEDVDAPC
SDLVKKLGQGSRSMDSVLTLSDYDLDQPEVEGLLTLSDFDLAHSKDEDVQMKRPLESKPV
NILVYTKIPLRDHARAPSAMCTPSYLSTAAANAAKSLRRHRRCSEPSIDYLDSKLSYLRE
FYQKKLRKSSCDAILSQKDEDYLKQNQPLQEEGKTCFKQSLVTGTDVSKKNATTQNTKKK
SLSGSEGNHVKLFPKSKPVAISVASYSPMSSQDHSKNQPFDVNTSGYSPPHTADALKGPR
THRRCSEPNIEDQNRKLTYLRGIYSKKQHKTSCEAGLLHGEEDYLKRHKSLQMEGQKLIN
QSLVMGIEVGKSSTTNQNTEKVLPPRLNLCPRTSYSSLSSPGTSPSGSSVSSQDSAFSQI
SEHSVFTPTETSSPIDCTFQAQRKREELSPDFSNASHVSGMPGPSSRQACSRPAYTKKDT
MEWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPPPHASGV
PEANSLQEEQKDLPLRAAEGLSPVQSAQRCSSSPFQDSERHCSSPFSLVESRLKLCMKSH
EEIEPGSQSSSGSLPWERASASSWTLEDATSPDSGPTVVCDIEDRYLTKDI
Download sequence
Identical sequences K7BG92
9598.ENSPTRP00000007329 XP_009422412.1.37143 ENSPTRP00000007329 ENSPTRP00000007329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]