SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007657 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007657
Domain Number 1 Region: 211-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000455
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 131-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000153
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 3 Region: 169-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000472
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 4 Region: 86-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000728
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007657
Domain Number - Region: 265-329
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.000863
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 
Domain Number - Region: 407-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00161
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 342-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00429
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007657   Gene: ENSPTRG00000004477   Transcript: ENSPTRT00000008294
Sequence length 733
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:127922742:127951727:-1 gene:ENSPTRG00000004477 transcript:ENSPTRT00000008294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLLHFPTKEQFDEAEPATLNGLDQPEQTTIPIPQLPQETQSSLEHEPETHTLHLQPQHE
ESVVPTQSTLTADDMRRAKRIRYVFQNAALQHLFIRKSFRPFKCLQCGKAFREKDKLDQH
LRFHGREGNCPLTCDLCNKGFISSASLESHMKLHSDQKTYSCIFCPESFDRLDLLKDHVA
IHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLRLHMLRHSD
RKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITSTDYDSFTFK
CRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKVYKSASKRK
AHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCSKQYSSKTK
MVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLTQAMTELSQ
TLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVAPATSPHQSQQSTVDVGQL
HDPQPYPQHAIQVQHIQVSEPTASAPSSAQVSGQPLSPSAQQAQQGLSPSHIQGSSSTQG
QALQQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQ
VKAVTSGHYVLSESQSELEEKQASALSGGVQVQPPAHSDSLDPQTTSQQQTTQYIITTTT
NGNGSSEVHITKP
Download sequence
Identical sequences ENSPTRP00000007657 ENSPTRP00000007657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]