SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007670 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007670
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-91
Family Eukaryotic proteases 0.00000000324
Further Details:      
 
Domain Number 2 Region: 339-447
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 3 Region: 227-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000536
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 488-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000603
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007670   Gene: ENSPTRG00000004481   Transcript: ENSPTRT00000008307
Sequence length 855
Comment pep:known chromosome:CHIMP2.1.4:11:128181795:128233409:1 gene:ENSPTRG00000004481 transcript:ENSPTRT00000008307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRARKGGGGPKDFGAGLKYNSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAA
VLIGLLLVLLGIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDSKTVQRTQDNSCSFGLHARGVELMRFTTPGFPDSPYPA
HARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVMVYNTLSPMEPHALVQLCGTYPPS
YNLTFHSSQNVLLVTLITNTRRRHPGFEATFFQLPRMRSCGGRLRKAQGTFNSPYYPGHY
PPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTS
NSNKITVRFHSDQSYTDTGFLAEYVSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDH
SDELNCSCDASHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSRWRTCSR
AGRPVGVGGAGLGEGVGCCRTVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEK
DCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYID
DRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKP
AEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT
RLPLFRDWIKENTGV
Download sequence
Identical sequences ENSPTRP00000007670 ENSPTRP00000007670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]