SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007868 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007868
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.74e-63
Family Eukaryotic proteases 0.000000144
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-24
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 3 Region: 190-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000079
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007868   Gene: ENSPTRG00000004607   Transcript: ENSPTRT00000008517
Sequence length 487
Comment pep:known chromosome:CHIMP2.1.4:12:7334121:7349193:-1 gene:ENSPTRG00000004607 transcript:ENSPTRT00000008517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEP
YGKGQESSTDIKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISAGGSDPSQFCGQQGSPLG
RPPGQREFVSSGRSLRLIFRTQPSSENKTAHLHKGFLALYQTVAVNYSQPISEASRGSEA
INAPGDNPAKVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPIA
QNQTTLGSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDSVSLRKNQSVN
VFLGHTAIDEMLKLGNHPVHRVVVHPDYRQNESHDFSGDIALLELQHSIPLGPNVLPVCL
PDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDHMF
CVGDETQRHSVCQGDSGSVYVVWDNHAHHWVATGIVSWGIGCGEGYDFYTKVLSYVDWIK
GVMNGKN
Download sequence
Identical sequences H2Q5C0
ENSPTRP00000007868 ENSPTRP00000007868 XP_001163902.1.37143 XP_003820314.1.60992 9598.ENSPTRP00000007868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]