SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007879 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007879
Domain Number 1 Region: 669-780
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 884-987
Classification Level Classification E-value
Superfamily SRCR-like 9.55e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 220-325
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 6-110
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 6 Region: 431-536
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 
Domain Number 7 Region: 536-643
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00071
Further Details:      
 
Domain Number 8 Region: 327-426
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 9 Region: 774-883
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007879   Gene: ENSPTRG00000004613   Transcript: ENSPTRT00000008528
Sequence length 1112
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:7713156:7735421:-1 gene:ENSPTRG00000004613 transcript:ENSPTRT00000008528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKATGWA
NSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTNG
GNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFD
DLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQ
GEWGTICDDGWDSYDAAVACKQLGCPTAITAIGRVNASEGFGHIWLDSVSCQGHEPAVWQ
CKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGL
KEADVVCRQLGCGSALKTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDH
YEEANIYFSAHREPRLVGGDIPCSGRVEVKHGDMWGSVCDSDFSLEAASVLCRELQCGTV
VSLLGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIR
LVNGKTPCEGRVELKTLGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQ
VWRHMFHCTGTEQHMGDCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPT
IPEESAVACIESGQLRLVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGE
AINATGSAYFGEGTGPIWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSL
RLTSEASREACAGRLEVFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINSASLDKAM
SIPMWVDNVQCPKGPDTLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEI
WHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESS
LWDCPARRWGHSECGHKEDAAVNCTDISVQKTPLFSALGRSSRQSSFIAVGILGVVLLAI
FVALFFLTKKRRQRQRLAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESANFS
AAELISVSKFLPISGMEKEAILSHTEKENGNL
Download sequence
Identical sequences ENSPTRP00000007879 ENSPTRP00000007879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]