SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008173 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008173
Domain Number 1 Region: 370-470
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.05e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 108-177
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.59e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 191-245,273-287
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000838
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008173   Gene: ENSPTRG00000004788   Transcript: ENSPTRT00000008843
Sequence length 635
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:61082614:61170081:-1 gene:ENSPTRG00000004788 transcript:ENSPTRT00000008843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPS
QSGIMTEKVVEKLSQNPLTYLLSTRIEISASSGSRVEDGEHQVKMKAFREAHSQTEKRRR
DKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDN
ELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVK
EQLSSFDISPREKLIDAKTGLQVHSNLHTGRTRVYSGSRRSFFCRIKSCKISVKEEHGCL
PNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYIVPQN
SGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKH
KAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGE
ASFFPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSS
PTGLMKDTHTVNCRSMSNKELFPPSPEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDA
LCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences A0A2I3SVJ1
9598.ENSPTRP00000008173 ENSPTRP00000008173 XP_003313824.1.37143 ENSPTRP00000008173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]