SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009005 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009005
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.00000167
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000379
Family SOCS box-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009005   Gene: ENSPTRG00000005299   Transcript: ENSPTRT00000009740
Sequence length 198
Comment pep:known chromosome:CHIMP2.1.4:12:93784454:93790809:1 gene:ENSPTRG00000005299 transcript:ENSPTRT00000009740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences G3R3V9 H2Q6L9
ENSGGOP00000009942 XP_004053727.1.27298 XP_009424275.1.37143 XP_009424276.1.37143 XP_009424277.1.37143 XP_009424278.1.37143 ENSPTRP00000009005 9598.ENSPTRP00000009005 ENSGGOP00000009942 ENSPTRP00000009005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]