SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009913 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009913
Domain Number 1 Region: 332-465,767-942
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 64-187
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-29
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 1146-1212
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.86e-19
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Domain Number 4 Region: 233-302
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.87e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000577
Further Details:      
 
Domain Number 5 Region: 173-229
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009913   Gene: ENSPTRG00000005823   Transcript: ENSPTRT00000010709
Sequence length 1220
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL392075.1:3092399:3276768:1 gene:ENSPTRG00000005823 transcript:ENSPTRT00000010709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIKN
ENGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLV
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV
Download sequence
Identical sequences ENSPTRP00000009913 9598.ENSPTRP00000009913 ENSPTRP00000009913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]