SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010081 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010081
Domain Number 1 Region: 891-1072
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1047-1168
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 3 Region: 191-221,312-441
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 6.01e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000010081
Domain Number - Region: 436-497
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0641
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010081   Gene: ENSPTRG00000005932   Transcript: ENSPTRT00000010889
Sequence length 1298
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:75199175:75400399:-1 gene:ENSPTRG00000005932 transcript:ENSPTRT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIEDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGR
AQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQN
SGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIFLRV
ASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVIFLSGEDDPEKIEERKKSKELR
SLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNC
RAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLT
AQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLL
HMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISP
SLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENI
VEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSEPLE
KLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQK
TVEQLRKLLPADALANCDLLLRDLNCNPNNKAKIGNKP
Download sequence
Identical sequences 9598.ENSPTRP00000010081 ENSPTRP00000010081 ENSPTRP00000010081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]