SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010586 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010586
Domain Number 1 Region: 322-543
Classification Level Classification E-value
Superfamily vWA-like 6.85e-52
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 162-351
Classification Level Classification E-value
Superfamily vWA-like 6.68e-43
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 29-124
Classification Level Classification E-value
Superfamily LCCL domain 3.92e-28
Family LCCL domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010586   Gene: ENSPTRG00000006237   Transcript: ENSPTRT00000011442
Sequence length 550
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:29750113:29766190:1 gene:ENSPTRG00000006237 transcript:ENSPTRT00000011442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFS
VYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSAS
FTVTKGKSSTQEATGQAVSTAHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRR
FNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGG
NSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVS
VAKPIPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSK
TCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFS
FTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSYD
DVQGPAAAAHDAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRG
ICRDFLESQQ
Download sequence
Identical sequences A0A2I2YYV4 A0A2I3SPC0 O43405
ENSGGOP00000021912 gi|205277471|ref|NP_001128530.1| gi|4758022|ref|NP_004077.1| ENSP00000216361 ENSP00000379862 NP_001128530.1.87134 NP_001128530.1.92137 NP_004077.1.87134 NP_004077.1.92137 XP_001171057.1.37143 XP_004055095.1.27298 XP_008972946.1.60992 ENSGGOP00000021912 ENSP00000216361 ENSP00000379862 ENSPTRP00000010586 ENSPTRP00000010586 ENSP00000216361 9598.ENSPTRP00000010586 9606.ENSP00000216361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]