SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010773 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010773
Domain Number 1 Region: 576-664
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 519-575
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000068
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000010773
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00887
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010773   Gene: ENSPTRG00000006355   Transcript: ENSPTRT00000011636
Sequence length 687
Comment pep:known chromosome:CHIMP2.1.4:14:51808971:51906283:-1 gene:ENSPTRG00000006355 transcript:ENSPTRT00000011636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQPGYIRD
LITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRL
IRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGY
IFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences A0A2I2Y2T0 H2Q8B8
ENSPTRP00000010773 ENSP00000342858 ENSP00000451084 ENSP00000342858 ENSP00000451084 NP_001128471.1.87134 NP_001128471.1.92137 XP_003314374.1.37143 XP_003831754.1.60992 XP_018865598.1.27298 ENSPTRP00000010773 9598.ENSPTRP00000010773 9606.ENSP00000342858 gi|201861813|ref|NP_001128471.1| ENSP00000342858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]