SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010805 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010805
Domain Number 1 Region: 115-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-46
Family Galectin (animal S-lectin) 0.00000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010805   Gene: ENSPTRG00000006370   Transcript: ENSPTRT00000011668
Sequence length 250
Comment pep:known chromosome:CHIMP2.1.4:14:54099377:54115796:1 gene:ENSPTRG00000006370 transcript:ENSPTRT00000011668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPRQAPP
GAYPGAPGAYPGAPASGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGSVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLAISGDI
DLTSASYTMI
Download sequence
Identical sequences H2Q8C5
ENSPTRP00000010805 ENSPTRP00000010805 9598.ENSPTRP00000010805 XP_001148424.2.37143 XP_009426120.1.37143 XP_009426121.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]