SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000013681 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000013681
Domain Number 1 Region: 218-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 35-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-19
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 3 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000382
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000013681   Gene: ENSPTRG00000008007   Transcript: ENSPTRT00000014772
Sequence length 330
Comment pep:novel chromosome:CHIMP2.1.4:16:30668671:30671273:-1 gene:ENSPTRG00000008007 transcript:ENSPTRT00000014772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPSLGLTVPMAPPLAPLPPRDPNGAGPEWRKPGAVSFADVAVYFSREEWGCLRPAHRA
LYRDVMRETYGHLGALGVGGSKPALISWVEEKAELWDPAAQDPEVAKCPTEADPDSRNKE
EEKQREGTGALEKPDPVAAGSPGLKAPQAPFAGLEQLSKARRRSRPRFFAHPSVPRADQR
HGCYVCGKSFAWRSTLVEHIYSHRGEKPFHCADCGKGFGHASSLSKHRAIHRGERPHRCP
ECGRAFMRRTALTSHLRVHTGEKPYRCPQCGRCFGLKTGMAKHQWVHQPGGEGRRGRRPG
GLSVTLTPVRGDLDPPVGFQLYPEIFQECG
Download sequence
Identical sequences ENSPTRP00000013681 ENSPTRP00000013681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]