SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014401 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014401
Domain Number 1 Region: 44-163
Classification Level Classification E-value
Superfamily PX domain 2.07e-16
Family PX domain 0.0037
Further Details:      
 
Domain Number 2 Region: 245-299
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000255
Family SAM (sterile alpha motif) domain 0.0059
Further Details:      
 
Domain Number 3 Region: 842-872
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014401   Gene: ENSPTRG00000008446   Transcript: ENSPTRT00000015559
Sequence length 896
Comment pep:known_by_projection chromosome:CHIMP2.1.4:16:87092158:87146755:-1 gene:ENSPTRG00000008446 transcript:ENSPTRT00000015559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPRTEAPVSSVSNSLENALHTSAHSTEESLPKRPLGKHSKVSVEKIDLKGLSHTKNDRN
VECSFEVLWSDSSITSVTKSSSEVTEFISKLCQLYPEENLEKLIPFLAGPDAFYVERNHV
DLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSGRPVC
GVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDTSPAILMPSSLQTP
QTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQLEL
EKEKSERRCLNSSAPPLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEVEQPHHQLPRE
GSSSEYSSSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARPT
AQVLPVQNEASSNPSGHHPLPPQMLSAASHIAPIRMLNSVHKPERGSADMKLLSSSVHSL
LSLEERNKGSGPRSSMKVDKSFGSAMMDVLPASAPHQPVQVLSGLSESSSMSPTVSFGPR
TKVVHASTLDRVLKTAQQPALVVETSTAATGTPSTVLHAARPPIKLLLSSSVPADSAISG
QTSCPNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGFCANSNTASPSSHP
STSFANMATLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIPASNPNHHHHHHHQQPP
APPQPAPPPPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFPFLPFSPMCSS
GYVSAQQYGGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTAGVYQTQGLVG
SSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSPTRP00000014401 ENSPTRP00000014401 9598.ENSPTRP00000014401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]