SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014575 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014575
Domain Number 1 Region: 24-295
Classification Level Classification E-value
Superfamily L domain-like 1.59e-57
Family Ngr ectodomain-like 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014575   Gene: ENSPTRG00000008541   Transcript: ENSPTRT00000015753
Sequence length 441
Comment pep:known chromosome:CHIMP2.1.4:17:1875010:1968356:-1 gene:ENSPTRG00000008541 transcript:ENSPTRT00000015753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVF
LQNNRISLLQPGRFSPAMVTLWMYSNNITYIHPGTFEGFVHLEELDLGDNRQLRTLAPET
FQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDGIFVDLVNLSHLFL
HGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGEC
LAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAED
FRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPR
NRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
SASSLGASLLAWTLGLAVTLR
Download sequence
Identical sequences H2QBU8
XP_016786649.1.37143 ENSPTRP00000014575 ENSPTRP00000014575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]