SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014740 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014740
Domain Number 1 Region: 714-970
Classification Level Classification E-value
Superfamily RNI-like 3.73e-49
Family 28-residue LRR 0.0000743
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 2.59e-21
Family Pyrin domain, PYD 0.00000374
Further Details:      
 
Domain Number 3 Region: 1344-1430
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-17
Family Caspase recruitment domain, CARD 0.021
Further Details:      
 
Domain Number 4 Region: 313-415,450-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000311
Family Nucleotide and nucleoside kinases 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014740   Gene: ENSPTRG00000008637   Transcript: ENSPTRT00000015929
Sequence length 1441
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:5546724:5615276:-1 gene:ENSPTRG00000008637 transcript:ENSPTRT00000015929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCTQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPW
IHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTST
AVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGT
PPQAHASLQPHHHPWEPSVRESLCSTWPWKNEDLNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPGLDTQEPRVVILQGAAGIGKSTLARQVKEAWGRGQLYGDR
FQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYKYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKQKEKL
TLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTLLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDKKGRGKHSNCIIDLEKMLEAY
GIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLH
CLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSHHVKKLQLIEGRQHRSTWS
PTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNLLSHSAVKSLCKTLRRPRCLLE
TLRLAGCGLRAEDCKDLAFGLRANQALTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIHLGLDQ
MTLSDEMRQELRALEQEKPQLLIFSRRAASHVAQANLKLLDVSKIFPIAEIAEESSPEVV
PVELLCVPSPASQGDLHMKPLGTDDDFWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPN
TGLCFVVREAVTVEIEFCVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVAL
QGGHVDTSLFQVAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVT
SVVLLYHRLHPEEVTFHLYLIPSDCSIRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTV
SGSGSGMLEILPKELELCYRSPGEDQLFSEFYVGHLGSGIRLQVKDKKDETLVWEALVKP
GDLMPATTLVPPARLAVPSPLDAPQLLHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQ
YERVLAENTRPSQMRKLFSLSQSWDRKCKDRLYQALKETHPHLIMELWEKGSKKGLLPLS
S
Download sequence
Identical sequences ENSPTRP00000014740 9598.ENSPTRP00000014740 ENSPTRP00000014740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]