SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000014805 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000014805
Domain Number 1 Region: 117-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-65
Family Protein kinases, catalytic subunit 0.000000712
Further Details:      
 
Domain Number 2 Region: 393-436
Classification Level Classification E-value
Superfamily SH3-domain 0.00000194
Family SH3-domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000014805
Domain Number - Region: 10-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0763
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 
Domain Number - Region: 598-630
Classification Level Classification E-value
Superfamily UBA-like 0.085
Family UBA domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000014805   Gene: ENSPTRG00000008681   Transcript: ENSPTRT00000016000
Sequence length 661
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:7444972:7454295:1 gene:ENSPTRG00000008681 transcript:ENSPTRT00000016000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEAGSLWLLKLLRGIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFGPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEERARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEGCCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQ
NGRTFKVGSFPASAVMLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPAR
GQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRPPLSSS
SPQPSQPSRERLPWPKRKPPHNHPMGTPGARKAAALSGGLLPDPELQRKIMEVELSVHGV
THQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCRRILEHYQWDLSAASRYVLAR
P
Download sequence
Identical sequences A0A2J8KPN6
ENSPTRP00000014805 ENSPTRP00000014805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]