SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015097 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015097
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.65e-51
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 
Domain Number 2 Region: 223-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-46
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015097   Gene: ENSPTRG00000008853   Transcript: ENSPTRT00000016311
Sequence length 356
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:37396705:37419859:-1 gene:ENSPTRG00000008853 transcript:ENSPTRT00000016311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQKGRWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRAAPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAILPMMYPHPAYPMPFITTIPGGLYPSK
SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT
Download sequence
Identical sequences ENSPTRP00000015097 ENSPTRP00000015097 9598.ENSPTRP00000015188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]