SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000015508 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000015508
Domain Number 1 Region: 716-992
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-78
Family Protein kinases, catalytic subunit 0.000000000763
Further Details:      
 
Domain Number 2 Region: 47-214
Classification Level Classification E-value
Superfamily L domain-like 2.84e-42
Family L domain 0.000000415
Further Details:      
 
Domain Number 3 Region: 337-525
Classification Level Classification E-value
Superfamily L domain-like 3.69e-42
Family L domain 0.000000245
Further Details:      
 
Domain Number 4 Region: 511-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7e-22
Family Growth factor receptor domain 0.000000112
Further Details:      
 
Domain Number 5 Region: 189-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.68e-16
Family Growth factor receptor domain 0.0000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000015508   Gene: ENSPTRG00000009100   Transcript: ENSPTRT00000016760
Sequence length 1247
Comment pep:known chromosome:CHIMP2.1.4:17:17658279:17687092:-1 gene:ENSPTRG00000009100 transcript:ENSPTRT00000016760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLP
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEKGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDVGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPREGPLPAARPAGATLEKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPH
PPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Download sequence
Identical sequences ENSPTRP00000015508 9598.ENSPTRP00000015508 ENSPTRP00000015508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]