SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016288 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016288
Domain Number 1 Region: 157-351
Classification Level Classification E-value
Superfamily E set domains 7.46e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-21
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016288   Gene: ENSPTRG00000009589   Transcript: ENSPTRT00000017582
Sequence length 418
Comment pep:known_by_projection chromosome:CHIMP2.1.4:17:68866030:68926446:1 gene:ENSPTRG00000009589 transcript:ENSPTRT00000017582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYHIVNVDAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences A0A2J8KKT4
ENSGGOP00000028458 XP_003808993.1.60992 XP_004041137.1.27298 XP_008959343.1.60992 XP_008959344.1.60992 XP_008959345.1.60992 XP_009431435.1.37143 XP_009431436.1.37143 XP_009431437.1.37143 XP_016788336.1.37143 XP_018884187.1.27298 XP_018884188.1.27298 XP_018884189.1.27298 XP_523700.2.37143 ENSPTRP00000016288 ENSPTRP00000016288 9598.ENSPTRP00000016288 ENSGGOP00000028458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]