SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000016415 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000016415
Domain Number 1 Region: 424-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-26
Family SPRY domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-17
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 174-237
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000013
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000016415   Gene: ENSPTRG00000009661   Transcript: ENSPTRT00000017718
Sequence length 642
Comment pep:known chromosome:CHIMP2.1.4:17:74829105:74833525:-1 gene:ENSPTRG00000009661 transcript:ENSPTRT00000017718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPALAPEPSAPSAPPSAPPSAPEPSAPCA
PEPWPAGEEPVRCDACLEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQSKVLSAVE
DRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAATLQGFQTQVLGFIEEGEAAM
LGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPGPGPPRE
LSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLES
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGL
EAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSR
LDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences H2QDW6
ENSPTRP00000016415 9598.ENSPTRP00000016415 XP_001147664.1.37143 ENSPTRP00000016415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]