SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017417 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017417
Domain Number 1 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-24
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 455-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 2-41
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-16
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 205-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000178
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 504-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000141
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 374-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000016
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 9 Region: 290-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000209
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 112-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000108
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000017417
Domain Number - Region: 135-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00028
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017417   Gene: ENSPTRG00000010249   Transcript: ENSPTRT00000018819
Sequence length 540
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:2930578:2942079:-1 gene:ENSPTRG00000010249 transcript:ENSPTRT00000018819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVVFEEVAVNFTPEEWALLDHAQRSLYRDVMLETCRNCYIYVRTSGSSSQRDVFGNGI
SNDEEIVKFTGSDSWSLFGENWRFDNIGDQHQIPQRHLRSQLWRLCESNEGHQCGETLSQ
TANLLVHKSYPTEAKPSECTKCGKAFENRQRSHTGQRPCKECGQACSCLSCQSPPMKTQT
VEKPCNCQDSRTASATYVKSLSSKKSYECKKCGKAFTCPSSFRAHVNSHHGQKTHACKVC
GKTFMYYSYLTRHIRTHTGEKPYECKECGKAFSCPSYFREHVRTHTGEKPYECKHCGKSF
SCYSSFRDHVRTHTGEKPCRCKHCGKAFTCYSSLREHGRTHSGEKPYECKECGKAFRYPS
SLRAHMRMHTGEKPYVCKQCGKAFGCPTYFRRHVKTHSGVKPYECKECGKAYSFSSSLRI
HVRTHTGEKPFECKHCGKAFSCHSSLREHVRTHSGEKPYECNQCGKAFSHAQYFQKHVRS
HSGVKPYECTECGKAYSCSSSLRVHVRTHTGERPYECKQCGKTFRYLASLQAHVRTHAGA
Download sequence
Identical sequences 9598.ENSPTRP00000017417 ENSPTRP00000017417 ENSPTRP00000017417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]