SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017888 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017888
Domain Number 1 Region: 398-661
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-49
Family YWTD domain 0.0000000000977
Further Details:      
 
Domain Number 2 Region: 283-394,666-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000209
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 104-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 4 Region: 142-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 5 Region: 26-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 6 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 7 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000954
Further Details:      
 
Domain Number 8 Region: 234-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 9 Region: 274-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017888   Gene: ENSPTRG00000010490   Transcript: ENSPTRT00000019326
Sequence length 860
Comment pep:known chromosome:CHIMP2.1.4:19:11308707:11352128:1 gene:ENSPTRG00000010490 transcript:ENSPTRT00000019326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGK
CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQHCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDE
FQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQH
PDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYT
SLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLA
VDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTVLE
DEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQ
PRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
TQETSTVRLKVSSTAVRTQHTTTRPVPNTSRLPGATPGLTTVEIVTTSHQALGDVAGRGN
EKKPSSVRALSIILPIVLLVFLCLGAFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICR
NQDGYSYPSRQMVSLEDDVA
Download sequence
Identical sequences K7BZX3
9598.ENSPTRP00000017888 ENSPTRP00000017888 ENSPTRP00000017888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]