SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017974 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017974
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 49-105
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-20
Family KRAB domain (Kruppel-associated box) 0.00068
Further Details:      
 
Domain Number 6 Region: 437-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 9 Region: 394-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 187-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000589
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017974   Gene: ENSPTRG00000022562   Transcript: ENSPTRT00000019418
Sequence length 663
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:12530060:12552455:-1 gene:ENSPTRG00000022562 transcript:ENSPTRT00000019418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCYGTFWGYPKMLEAANLMEGLVDMGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVN
FTHEEWALLSPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQYQNLRRNPRCDVVERFG
KSKDGSQCGETLSQIRNSIVNKNTPTRVDTCGSSVNGEVIMGHSSLNCYIRVDTGHKHRE
CHEYAEKSYTHKQCGEGLSYRHSFQTCERPHTGKKPYDCKECGKTFSSPGNLRRHMVVKG
GDGPYKCELCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPVYSSYLRHEKIHTGEKP
YECKQCSKAFPDYSSYLRHERTHTGEKPYKCKQCGKAFSVSGSLRVHERIHTGEKPYTCK
QCGKAFCHLGSFRRHMIMHSGDGPHKCKICGKGFDFPGSARIHEGTHTLEKPYECKQCGK
LLSHRSSFRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRT
SSSLRKHETTHTGEQPYKCKCGKAFSDFFSFQSHETTHSEEEPYECKECGKAFSSFKYFC
RHERTHSEEKSYECQICGKAFSRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLLRHER
THTGERPYECKHCGKAFSRSSFCREHERTHTGEKPYECKECGKAFSSLSSFNRHKRTHWK
DIL
Download sequence
Identical sequences A0A2J8LVH2
ENSPTRP00000017974 ENSPTRP00000017974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]