SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019472 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019472
Domain Number 1 Region: 219-363
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.18e-34
Family Nuclear receptor ligand-binding domain 0.0000000822
Further Details:      
 
Domain Number 2 Region: 85-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019472   Gene: ENSPTRG00000011337   Transcript: ENSPTRT00000021089
Sequence length 363
Comment pep:known chromosome:CHIMP2.1.4:19:55327246:55331684:1 gene:ENSPTRG00000011337 transcript:ENSPTRT00000021089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
RRL
Download sequence
Identical sequences ENSPTRP00000019472 ENSPTRP00000019472 9598.ENSPTRP00000019472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]