SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020986 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020986
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-37
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020986   Gene: ENSPTRG00000012244   Transcript: ENSPTRT00000022738
Sequence length 183
Comment pep:known chromosome:CHIMP2.1.4:2A:97102588:97112626:-1 gene:ENSPTRG00000012244 transcript:ENSPTRT00000022738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQP
DSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHG
SNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDL
LSS
Download sequence
Identical sequences H2QID6 Q53RE8
NP_057550.3.87134 NP_057550.3.92137 XP_515633.3.37143 ENSP00000377170 ENSP00000398321 ENSPTRP00000020986 ENSP00000377170 ENSPTRP00000020986 ENSP00000377170 ENSP00000398321 9598.ENSPTRP00000020986 9606.ENSP00000377170 gi|156142184|ref|NP_057550.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]