SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021008 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021008
Domain Number 1 Region: 343-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-72
Family Protein kinases, catalytic subunit 0.000000000191
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-30
Family SH2 domain 0.000000422
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-29
Family SH2 domain 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021008   Gene: ENSPTRG00000012259   Transcript: ENSPTRT00000022764
Sequence length 619
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:97886493:97912806:1 gene:ENSPTRG00000012259 transcript:ENSPTRT00000022764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARVT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA
Download sequence
Identical sequences H2QIE3
ENSPTRP00000021008 ENSGGOP00000001498 XP_016804534.1.37143 XP_515637.2.37143 9598.ENSPTRP00000021008 ENSPTRP00000021008 ENSGGOP00000001498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]