SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022498 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022498
Domain Number 1 Region: 80-325
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.9e-37
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022498   Gene: ENSPTRG00000013143   Transcript: ENSPTRT00000024390
Sequence length 355
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:347832:356816:1 gene:ENSPTRG00000013143 transcript:ENSPTRT00000024390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRATPLAAPAGSLSRKKRLELDDKLDTERPVQKRARSAPQPRLPPCLLPLSPPTAPDRAT
AVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
ARPTEVLAGTQLLYAFFTRTRGDMHSLVRTAHPAEAAALFRQMASALAHCHQHGLVLRDL
KLCRFVFTDRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAAD
VWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVHCLLRREPAER
LTATGILLHPWLREEPIPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG
Download sequence
Identical sequences ENSPTRP00000022498 ENSPTRP00000022498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]