SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022929 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022929
Domain Number 1 Region: 49-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000036
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 187-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000154
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 94-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000294
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 128-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000285
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022929   Gene: ENSPTRG00000013374   Transcript: ENSPTRT00000024840
Sequence length 496
Comment pep:known chromosome:CHIMP2.1.4:20:28931020:28946292:-1 gene:ENSPTRG00000013374 transcript:ENSPTRT00000024840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHGL
PQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR
RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK
SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGA
HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVD
SFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT
SGLSSTTLPRFHQAFQ
Download sequence
Identical sequences H2QK61
ENSPTRP00000022929 9598.ENSPTRP00000022929 XP_003316959.1.37143 XP_016793149.1.37143 ENSPTRP00000022929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]